PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462930528
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 273aa    MW: 31403.5 Da    PI: 10.2951
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462930528genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B352.11.2e-16511191786
                E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                 l ++f++++g+ k++++tl+    s r W+v+     + ++y+l +GW++F+++n LkegD+++F  ++
  462930528  51 ALARDFCDAIGLRKHCTITLKSSMDSTRYWSVQGA-GYNNNSYILHQGWRRFCQENSLKEGDVCTFNIIE 119
                5889*********99965555555777*******4.334456************************9765 PP

2B359.55.9e-19179262186
                EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                ++k++++ ++++ + ++lp +f+ ++g+ +++ +tl+   +s+ sW+ ++ + kk + ++ ++GWk+F+++ngLkegD+++F  ++
  462930528 179 WIKKTINTSTMEYQ-FSLPLSFCVAIGLREPCIVTLKTSMSSSMSWQARV-VPKKYNNHMCGSGWKRFCQENGLKEGDICTFNIIE 262
                67899999999987.**************99988888888999*******.56666789***********************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010190.00440131IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.9E-1741129IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-1551130IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.94252131IPR003340B3 DNA binding domain
PfamPF023629.2E-1352119IPR003340B3 DNA binding domain
CDDcd100173.44E-1054115No hitNo description
PROSITE profilePS5086312.012178273IPR003340B3 DNA binding domain
SMARTSM010195.1E-6180273IPR003340B3 DNA binding domain
CDDcd100172.66E-11180258No hitNo description
PfamPF023622.4E-16180269IPR003340B3 DNA binding domain
SuperFamilySSF1019365.1E-19181272IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.3E-20182272IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MQAREPPAAA MSNKNPPRRP QFINVLPRGF MDKMWIIGHK LKLVRLQLLQ ALARDFCDAI  60
GLRKHCTITL KSSMDSTRYW SVQGAGYNNN SYILHQGWRR FCQENSLKEG DVCTFNIIET  120
ALWHVVIMRC KEKIKQFFNK GEQDRSISEE PRETKGSMTS VNKASSARKR VFDIGPAAWI  180
KKTINTSTME YQFSLPLSFC VAIGLREPCI VTLKTSMSSS MSWQARVVPK KYNNHMCGSG  240
WKRFCQENGL KEGDICTFNI IETTLWHVII VRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0A9S1932e-83A0A0A9S193_ARUDO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24680.22e-10B3 family protein